$2,749.77
CAS Number
:223460-79-5
Molecular Formula
C126H207N37O34S
| Weight | 2816.28 kg |
|---|---|
| Purity | BR |
| Pack Size | 1mg |
| Storage Condition | -20Degree Celsius |
| Form |
Be the first to review “GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD”
No additional product information available.
Related products
Chiral Catalysts
$121.27
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$45.05 – $2,830.22
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
$18.13 – $679.43
This product has multiple variants. The options may be chosen on the product page
Chiral Catalysts
$15.02 – $794.47
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
(+)-4?5-Bis[hydroxy(diphenyl)methyl]-2?2-dimethyl-1?3-dioxolane
$8.22 – $217.60
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$705.50 – $1,771.40
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$40.80 – $451.07
This product has multiple variants. The options may be chosen on the product page
Chiral Additives
$17.57 – $136.57
This product has multiple variants. The options may be chosen on the product page
Reviews
There are no reviews yet.