| Weight | 2816.28 kg |
|---|---|
| Purity | BR |
| Pack Size | 1mg |
| Storage Condition | -20Degree Celsius |
| Form |
$2,749.77
CAS Number
:223460-79-5
Molecular Formula
C126H207N37O34S
SKU: G860498
Categories: Fine Chemistry, Peptides Synthesis
Be the first to review “GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD” Cancel reply
No additional product information available.
Related products
chiral building blocks
$24.37 – $119.00
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
$17.00 – $744.03
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
(-)-4?5-Bis[hydroxy(diphenyl)methyl]-2?2-dimethyl-1?3-dioxolane
$8.50 – $130.62
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$40.80 – $451.07
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
(1R?2R?4R?5R)-2?5-Bis(3?5-di-|tert|-butyl-2-hydroxybenzylideneamino)bicyclo[2.2.1]heptane
$579.13
This product has multiple variants. The options may be chosen on the product page
Chiral Additives
$17.57 – $136.57
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
$19.83 – $1,040.40
This product has multiple variants. The options may be chosen on the product page
Cell Signaling and Neurobiology
$8.50 – $637.50
This product has multiple variants. The options may be chosen on the product page




Reviews
There are no reviews yet.