Fine Chemistry
$2,380.02
This product has multiple variants. The options may be chosen on the product page
$2,380.02
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
GLP-1(7-36)?Human GLP-1-(7-36)-amide?Insulinotropin?MKC253?Glucagon-like Peptide 1 (7-36) amide
$64.62
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$4,757.43
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD
$2,749.77
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$158.97 – $1,244.40
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$124.08
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$6,664.02
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$1,399.95 – $3,909.15
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$3,943.98
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$3,943.98
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$3,943.98
This product has multiple variants. The options may be chosen on the product page

