Fine Chemistry
GLP-1(7-36)?Human GLP-1-(7-36)-amide?Insulinotropin?MKC253?Glucagon-like Peptide 1 (7-36) amide
$64.62
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$4,757.43
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD
$2,749.77
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$1,361.70
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$73.10 – $201.73
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$158.97 – $1,244.40
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$61.76 – $1,047.76
This product has multiple variants. The options may be chosen on the product page
Enzymes and Coenzymes
$97.47 – $3,399.43
This product has multiple variants. The options may be chosen on the product page
Enzymes and Coenzymes
$106.53 – $1,302.77
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$1,104.15 – $1,817.28
This product has multiple variants. The options may be chosen on the product page
Carbohydrates
$44.20 – $696.89
This product has multiple variants. The options may be chosen on the product page
Carbohydrates
$43.45 – $615.84
This product has multiple variants. The options may be chosen on the product page

