| Weight | 2816.28 kg |
|---|---|
| Purity | BR |
| Pack Size | 1mg |
| Storage Condition | -20Degree Celsius |
| Form |
$2,749.77
CAS Number
:223460-79-5
Molecular Formula
C126H207N37O34S
SKU: G860498
Categories: Fine Chemistry, Peptides Synthesis
Be the first to review “GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD” Cancel reply
No additional product information available.
Related products
chiral building blocks
$18.13 – $679.43
This product has multiple variants. The options may be chosen on the product page
Carboxylic Acids
$20.40 – $330.08
This product has multiple variants. The options may be chosen on the product page
Chiral Catalysts
$54.51 – $1,105.00
This product has multiple variants. The options may be chosen on the product page
Amino AcidsAnd its derivatives
4-|tert|-Butyl N-[(tert-butoxy)carbonyl]-L-aspartate dicyclohexylamine salt
$25.50 – $253.30
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
Chiral Catalysts
$15.02 – $794.47
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$45.05 – $2,830.22
This product has multiple variants. The options may be chosen on the product page
Bioactive Small Molecules
$43.35 – $2,269.50
This product has multiple variants. The options may be chosen on the product page




Reviews
There are no reviews yet.