Biological Buffers
$8.50 – $402.05
This product has multiple variants. The options may be chosen on the product page
Enzyme Inhibitors
$337.47 – $904.38
This product has multiple variants. The options may be chosen on the product page
Carbohydrates
$8.50 – $250.18
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
Exendin derivative 1?HAEGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
$1,495.98
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$1,403.37
This product has multiple variants. The options may be chosen on the product page
Enzyme Inhibitors
$732.72
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$26.63 – $534.37
This product has multiple variants. The options may be chosen on the product page
Enzyme Inhibitors
$414.78 – $4,206.63
This product has multiple variants. The options may be chosen on the product page
Enzyme Inhibitors
$107.10 – $3,028.53
This product has multiple variants. The options may be chosen on the product page
Enzyme Inhibitors
$29.73 – $913.77
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$701.25
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$1,045.50
This product has multiple variants. The options may be chosen on the product page

